PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G280300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 340aa    MW: 38374.1 Da    PI: 4.882
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G280300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-092813162055
                        HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +k +yp+++++  LA+++gL+++q+ +WF N+R ++
  Aqcoe3G280300.1.p 281 YKWPYPTEADKLALAESTGLDQKQINNWFINQRKRH 316
                        4679*****************************885 PP

2ELK37.26.4e-13236257122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        +LK+ LlrKYsgy++sLk+EFs
  Aqcoe3G280300.1.p 236 DLKDKLLRKYSGYISSLKHEFS 257
                        69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012555.5E-2298142IPR005540KNOX1
PfamPF037901.2E-20100140IPR005540KNOX1
SMARTSM012562.0E-24148199IPR005541KNOX2
PfamPF037911.6E-23152198IPR005541KNOX2
PROSITE profilePS5121310.737236256IPR005539ELK domain
PfamPF037891.2E-10236257IPR005539ELK domain
SMARTSM011882.2E-7236257IPR005539ELK domain
PROSITE profilePS5007112.827256319IPR001356Homeobox domain
SuperFamilySSF466891.03E-19257333IPR009057Homeodomain-like
SMARTSM003895.8E-13258323IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-28261320IPR009057Homeodomain-like
CDDcd000864.63E-13268320No hitNo description
PfamPF059209.0E-17276315IPR008422Homeobox KN domain
PROSITE patternPS000270294317IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MEEMYGFHSS TLIDYEEQQH QQQQQPLMLP ANMITPADYQ NLLCSGAFRD RIPIFGSDHL  60
FSAASSALCD TTSGIQTLGT SLDYHQGSSE GSGDMITSSI KARIASHPLY PCLLEAYIDC  120
QKVGAPPEIA GLLEEIRREN NVCKRSAVST RLGTDPELDE FMETYCDILV KYKSDLARPF  180
DEATAFLNNI ELQLGNLCKG PSRSCVSDEA AGSSEDEFSG GELEVPEFQP RSEDRDLKDK  240
LLRKYSGYIS SLKHEFSKKK KKGKLPKEAR QTLLEWWNLH YKWPYPTEAD KLALAESTGL  300
DQKQINNWFI NQRKRHWKPS ENMQFAVMDS LSAPFFIDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3315340.0KP331534.1 Aquilegia coerulea KXL2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010248543.11e-157PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-131KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLD7SHP31e-152D7SHP3_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g08710.t011e-151(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-125KNOTTED1-like homeobox gene 6